General Information

  • ID:  hor004578
  • Uniprot ID:  Q95274
  • Protein name:  Thymosin beta-4
  • Gene name:  TMSB4
  • Organism:  Sus scrofa (Pig)
  • Family:  Thymosin beta family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Sus (genus), Suidae (family), Suina (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0003779 actin binding; GO:0003785 actin monomer binding
  • GO BP:  GO:0007015 actin filament organization; GO:0030334 regulation of cell migration; GO:0042989 sequestering of actin monomers
  • GO CC:  GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0005829 cytosol; GO:0005856 cytoskeleton

Sequence Information

  • Sequence:  SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Length:  43(2-44)
  • Propeptide:  MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
  • Signal peptide:  NA
  • Modification:  T1 N-acetylserine;T1 Phosphoserine;T3 N6-acetyllysine;T11 N6-acetyllysine;T22 Phosphothreonine;T25 N6-acetyllysine;T30 Phosphoserine;T31 N6-acetyllysine;T33 Phosphothreonine;T38 N6-acetyllysine
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Plays an important role in the organization of the cytoskeleton.
  • Mechanism:  Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
  • Cross BBB:  NA
  • Target:  ACTG1
  • Target Unid:  I3LVD5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q95274-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor004578_AF2.pdbhor004578_ESM.pdb

Physical Information

Mass: 567077 Formula: C210H348N56O77S
Absent amino acids: CHRVWY Common amino acids: K
pI: 4.72 Basic residues: 9
Polar residues: 9 Hydrophobic residues: 7
Hydrophobicity: -170.23 Boman Index: -14559
Half-Life: 1.9 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 40.93
Instability Index: 6170.23 Extinction Coefficient cystines: 0
Absorbance 280nm: 0

Literature

  • PubMed ID:  NA
  • Title:  NA